Class b: All beta proteins [48724] (177 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.5: TrmB C-terminal domain-like [159071] (1 family) sugar-binding domain; permuted OB-fold? |
Family b.38.5.1: TrmB C-terminal domain-like [159072] (1 protein) C-terminal part of PfamB PB004822 |
Protein Transcriptional regulator TrmB [159073] (1 species) |
Species Thermococcus litoralis [TaxId:2265] [159074] (1 PDB entry) Uniprot Q7LYW4 247-338 |
Domain d2f5tx1: 2f5t X:247-338 [146996] Other proteins in same PDB: d2f5tx2, d2f5tx3 complexed with imd, mal |
PDB Entry: 2f5t (more details), 1.45 Å
SCOPe Domain Sequences for d2f5tx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f5tx1 b.38.5.1 (X:247-338) Transcriptional regulator TrmB {Thermococcus litoralis [TaxId: 2265]} npkdirffamfhavdfvknhlknrniyaeitgknlesgrletltgrvvgytlslreavnn ihletengvvkvggmfaviedyesteikfimg
Timeline for d2f5tx1: