Lineage for d2f5tx1 (2f5t X:247-338)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2787767Superfamily b.38.5: TrmB C-terminal domain-like [159071] (1 family) (S)
    sugar-binding domain; permuted OB-fold?
  5. 2787768Family b.38.5.1: TrmB C-terminal domain-like [159072] (1 protein)
    C-terminal part of PfamB PB004822
  6. 2787769Protein Transcriptional regulator TrmB [159073] (1 species)
  7. 2787770Species Thermococcus litoralis [TaxId:2265] [159074] (1 PDB entry)
    Uniprot Q7LYW4 247-338
  8. 2787771Domain d2f5tx1: 2f5t X:247-338 [146996]
    Other proteins in same PDB: d2f5tx2, d2f5tx3
    complexed with imd

Details for d2f5tx1

PDB Entry: 2f5t (more details), 1.45 Å

PDB Description: crystal structure of the sugar binding domain of the archaeal transcriptional regulator trmb
PDB Compounds: (X:) archaeal transcriptional regulator TrmB

SCOPe Domain Sequences for d2f5tx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f5tx1 b.38.5.1 (X:247-338) Transcriptional regulator TrmB {Thermococcus litoralis [TaxId: 2265]}
npkdirffamfhavdfvknhlknrniyaeitgknlesgrletltgrvvgytlslreavnn
ihletengvvkvggmfaviedyesteikfimg

SCOPe Domain Coordinates for d2f5tx1:

Click to download the PDB-style file with coordinates for d2f5tx1.
(The format of our PDB-style files is described here.)

Timeline for d2f5tx1: