SCOPe 2.03: Domain d2erwa1: 2erw A:4-56

Lineage for d2erwa1 (2erw A:4-56)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)

4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families)
   conserved core consists of a helix and a loop crosslinked with two disulfides

5. Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)

6. Protein Blood-sucking insect-derived tryptase inhibitor [57476] (2 species)
   duplication: contains two domains of this fold

7. Species Triatoma infestans [TaxId:30076] [161138] (2 PDB entries)
   Uniprot Q95P16 170-222! Uniprot Q95P16 5-50
   infestin

8. Domain d2erwa1: 2erw A:4-56 [146989]
   infestin 4

Details for d2erwa1

PDB Entry: 2erw, 1.4 Å

PDB Description: crystal structure of infestin 4, a factor xiia inhibitor

PDB Compounds: (A:) serine protease inhibitor infestin

SCOPe Domain Sequences for d2erwa1:

Sequence; same for both SEQRES and ATOM records:

>d2erwa1 g.68.1.1 (A:4-56) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]}
npcacfrnyvpvcgsdgktygnpcmlncaaqtkvpglklvhegrcqrsnveqf

Timeline for d2erwa1:

• d2erwa1 first appeared in SCOP 1.75
  
• d2erwa1 appears in SCOPe 2.02
  
• d2erwa1 appears in SCOPe 2.04
  
• d2erwa1 appears in the current release, SCOPe 2.08