Lineage for d2ersa1 (2ers A:31-89)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034014Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 3034015Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 3034016Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 3034256Protein Interleukin-15 receptor subunit alpha [161139] (2 species)
  7. 3034257Species Human (Homo sapiens) [TaxId:9606] [161141] (4 PDB entries)
    Uniprot Q13261 31-108! Uniprot Q13261 31-96
  8. 3034269Domain d2ersa1: 2ers A:31-89 [146988]

Details for d2ersa1

PDB Entry: 2ers (more details)

PDB Description: solution structure of the interleukin-15 receptor sushi domain
PDB Compounds: (A:) Interleukin-15 receptor alpha chain

SCOPe Domain Sequences for d2ersa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ersa1 g.18.1.1 (A:31-89) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]}
itcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwttp

SCOPe Domain Coordinates for d2ersa1:

Click to download the PDB-style file with coordinates for d2ersa1.
(The format of our PDB-style files is described here.)

Timeline for d2ersa1: