Lineage for d2eq3a1 (2eq3 A:704-733)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639864Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 2639865Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 2639866Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 2640089Protein automated matches [192458] (2 species)
    not a true protein
  7. 2640090Species Human (Homo sapiens) [TaxId:9606] [161316] (93 PDB entries)
  8. 2640129Domain d2eq3a1: 2eq3 A:704-733 [146983]
    Other proteins in same PDB: d2eq3a2, d2eq3a3
    automatically matched to d1znma_
    complexed with zn

Details for d2eq3a1

PDB Entry: 2eq3 (more details)

PDB Description: solution structure of the 17th c2h2 type zinc finger domain of zinc finger protein 347
PDB Compounds: (A:) Zinc finger protein 347

SCOPe Domain Sequences for d2eq3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eq3a1 g.37.1.1 (A:704-733) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tgekpyecnqcgkafsvrssltthqaihtg

SCOPe Domain Coordinates for d2eq3a1:

Click to download the PDB-style file with coordinates for d2eq3a1.
(The format of our PDB-style files is described here.)

Timeline for d2eq3a1: