| Class g: Small proteins [56992] (94 folds) |
| Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) ![]() |
| Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins) |
| Protein automated matches [192458] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [161316] (92 PDB entries) |
| Domain d2eq3a1: 2eq3 A:704-733 [146983] Other proteins in same PDB: d2eq3a2, d2eq3a3 automatically matched to d1znma_ complexed with zn |
PDB Entry: 2eq3 (more details)
SCOPe Domain Sequences for d2eq3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eq3a1 g.37.1.1 (A:704-733) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tgekpyecnqcgkafsvrssltthqaihtg
Timeline for d2eq3a1: