Lineage for d2epsa1 (2eps A:408-446)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035159Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 3035196Protein PATZ1 [161152] (1 species)
    Zinc finger protein 278
  7. 3035197Species Human (Homo sapiens) [TaxId:9606] [161153] (5 PDB entries)
    Uniprot Q9HBE1 286-338! Uniprot Q9HBE1 350-384! Uniprot Q9HBE1 355-379! Uniprot Q9HBE1 380-409! Uniprot Q9HBE1 380-411! Uniprot Q9HBE1 407-445! Uniprot Q9HBE1 410-436
  8. 3035203Domain d2epsa1: 2eps A:408-446 [146974]
    Other proteins in same PDB: d2epsa2, d2epsa3
    4th C2H2 finger
    complexed with zn

Details for d2epsa1

PDB Entry: 2eps (more details)

PDB Description: solution structure of the 4th zinc finger domain of zinc finger protein 278
PDB Compounds: (A:) POZ-, AT hook-, and zinc finger-containing protein 1

SCOPe Domain Sequences for d2epsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]}
svgkpyicqscgkgfsrpdhlnghikqvhtserphkcqv

SCOPe Domain Coordinates for d2epsa1:

Click to download the PDB-style file with coordinates for d2epsa1.
(The format of our PDB-style files is described here.)

Timeline for d2epsa1: