Lineage for d2ep6a1 (2ep6 A:92-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772796Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 2772816Protein Multiple C2 and transmembrane domain-containing protein 2, MCTP2 [158940] (1 species)
  7. 2772817Species Human (Homo sapiens) [TaxId:9606] [158941] (1 PDB entry)
    Uniprot Q6DN12 504-629
  8. 2772818Domain d2ep6a1: 2ep6 A:92-217 [146970]
    Other proteins in same PDB: d2ep6a2
    3rd C2 domain

Details for d2ep6a1

PDB Entry: 2ep6 (more details)

PDB Description: solution structure of the second c2 domain from human mctp2 protein
PDB Compounds: (A:) MCTP2 protein

SCOPe Domain Sequences for d2ep6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]}
dvkdvgilqvkvlkaadllaadfsgksdpfcllelgndrlqthtvyknlnpewnkvftfp
ikdihdvlevtvfdedgdkppdflgkvaipllsirdgqpncyvlknkdleqafkgviyle
mdliyn

SCOPe Domain Coordinates for d2ep6a1:

Click to download the PDB-style file with coordinates for d2ep6a1.
(The format of our PDB-style files is described here.)

Timeline for d2ep6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ep6a2