![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.5: Third domain of FERM [50776] (8 proteins) |
![]() | Protein Radixin [50779] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [50780] (9 PDB entries) |
![]() | Domain d2emtb2: 2emt B:199-297 [146932] Other proteins in same PDB: d2emta1, d2emta3, d2emta4, d2emtb1, d2emtb3, d2emtb4 automatically matched to d1gc6a2 |
PDB Entry: 2emt (more details), 2.8 Å
SCOPe Domain Sequences for d2emtb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2emtb2 b.55.1.5 (B:199-297) Radixin {Mouse (Mus musculus) [TaxId: 10090]} emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp
Timeline for d2emtb2:
![]() Domains from other chains: (mouse over for more information) d2emta1, d2emta2, d2emta3, d2emta4 |