Lineage for d2emta3 (2emt A:2-87)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932854Family d.15.1.4: First domain of FERM [54256] (6 proteins)
  6. 2932884Protein Radixin [54259] (1 species)
  7. 2932885Species Mouse (Mus musculus) [TaxId:10090] [54260] (9 PDB entries)
  8. 2932902Domain d2emta3: 2emt A:2-87 [146930]
    Other proteins in same PDB: d2emta1, d2emta2, d2emta4, d2emtb1, d2emtb2, d2emtb4
    automatically matched to d1gc6a3

Details for d2emta3

PDB Entry: 2emt (more details), 2.8 Å

PDB Description: crystal structure analysis of the radixin ferm domain complexed with adhesion molecule psgl-1
PDB Compounds: (A:) Radixin

SCOPe Domain Sequences for d2emta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2emta3 d.15.1.4 (A:2-87) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
pkpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkl
nkkvtqqdvkkenplqfkfrakffpe

SCOPe Domain Coordinates for d2emta3:

Click to download the PDB-style file with coordinates for d2emta3.
(The format of our PDB-style files is described here.)

Timeline for d2emta3: