Lineage for d2emta2 (2emt A:199-297)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803543Family b.55.1.5: Third domain of FERM [50776] (8 proteins)
  6. 2803573Protein Radixin [50779] (1 species)
  7. 2803574Species Mouse (Mus musculus) [TaxId:10090] [50780] (9 PDB entries)
  8. 2803591Domain d2emta2: 2emt A:199-297 [146929]
    Other proteins in same PDB: d2emta1, d2emta3, d2emta4, d2emtb1, d2emtb3, d2emtb4
    automatically matched to d1gc6a2

Details for d2emta2

PDB Entry: 2emt (more details), 2.8 Å

PDB Description: crystal structure analysis of the radixin ferm domain complexed with adhesion molecule psgl-1
PDB Compounds: (A:) Radixin

SCOPe Domain Sequences for d2emta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2emta2 b.55.1.5 (A:199-297) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp

SCOPe Domain Coordinates for d2emta2:

Click to download the PDB-style file with coordinates for d2emta2.
(The format of our PDB-style files is described here.)

Timeline for d2emta2: