Lineage for d2emsa2 (2ems A:199-297)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805150Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 805151Superfamily b.55.1: PH domain-like [50729] (13 families) (S)
  5. 805516Family b.55.1.5: Third domain of FERM [50776] (8 proteins)
  6. 805545Protein Radixin [50779] (1 species)
  7. 805546Species Mouse (Mus musculus) [TaxId:10090] [50780] (10 PDB entries)
  8. 805561Domain d2emsa2: 2ems A:199-297 [146926]
    Other proteins in same PDB: d2emsa1, d2emsa3
    automatically matched to d1gc6a2

Details for d2emsa2

PDB Entry: 2ems (more details), 2.9 Å

PDB Description: Crystal Structure Analysis of the radixin FERM domain complexed with adhesion molecule CD43
PDB Compounds: (A:) Radixin

SCOP Domain Sequences for d2emsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2emsa2 b.55.1.5 (A:199-297) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp

SCOP Domain Coordinates for d2emsa2:

Click to download the PDB-style file with coordinates for d2emsa2.
(The format of our PDB-style files is described here.)

Timeline for d2emsa2: