Lineage for d2elcc2 (2elc C:66-329)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861697Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2861698Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) (S)
    automatically mapped to Pfam PF00591
  5. 2861699Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 proteins)
  6. 2861700Protein Anthranilate phosphoribosyltransferase (TrpD) [82364] (3 species)
  7. 2861735Species Thermus thermophilus [TaxId:274] [102269] (2 PDB entries)
  8. 2861738Domain d2elcc2: 2elc C:66-329 [146902]
    Other proteins in same PDB: d2elca1, d2elcb1, d2elcc1, d2elcd1
    automated match to d1v8ga2
    complexed with gol, na

Details for d2elcc2

PDB Entry: 2elc (more details), 1.55 Å

PDB Description: Crystal structure of TTHA1842 from Thermus thermophilus HB8
PDB Compounds: (C:) Anthranilate phosphoribosyltransferase

SCOPe Domain Sequences for d2elcc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2elcc2 c.27.1.1 (C:66-329) Anthranilate phosphoribosyltransferase (TrpD) {Thermus thermophilus [TaxId: 274]}
lrvhrrplldivgtggdgkglmnlstlaalvaaaggvavakhgnraassragsadlleal
gvdleappervgeaieelgfgflfarvfhpamrhvapvraelgvrtvfnllgpltnpaga
dayvlgvfspewlapmaealerlgarglvvhgegadelvlgenrvvevgkgayaltpeev
glkraplealkgggpeenaalarrllkgeekgpladavalaagagfyaagktpslkegva
larevlasgeayllleryvaflra

SCOPe Domain Coordinates for d2elcc2:

Click to download the PDB-style file with coordinates for d2elcc2.
(The format of our PDB-style files is described here.)

Timeline for d2elcc2: