Lineage for d2elcc1 (2elc C:1-65)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327502Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 2327513Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 2327514Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)
  6. 2327515Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species)
  7. 2327550Species Thermus thermophilus [TaxId:274] [101213] (2 PDB entries)
  8. 2327553Domain d2elcc1: 2elc C:1-65 [146901]
    Other proteins in same PDB: d2elca2, d2elcb2, d2elcc2, d2elcd2
    automated match to d1v8ga1
    complexed with gol, na

Details for d2elcc1

PDB Entry: 2elc (more details), 1.55 Å

PDB Description: Crystal structure of TTHA1842 from Thermus thermophilus HB8
PDB Compounds: (C:) Anthranilate phosphoribosyltransferase

SCOPe Domain Sequences for d2elcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2elcc1 a.46.2.1 (C:1-65) Anthranilate phosphoribosyltransferase (TrpD) {Thermus thermophilus [TaxId: 274]}
mdavkkailgevleeeeayevmralmagevspvraagllvalslrgerpheiaamaramr
eaarp

SCOPe Domain Coordinates for d2elcc1:

Click to download the PDB-style file with coordinates for d2elcc1.
(The format of our PDB-style files is described here.)

Timeline for d2elcc1: