![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
![]() | Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) ![]() automatically mapped to Pfam PF02885 |
![]() | Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins) |
![]() | Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [101213] (2 PDB entries) |
![]() | Domain d2elcb1: 2elc B:1-65 [146899] Other proteins in same PDB: d2elca2, d2elcb2, d2elcc2, d2elcd2 automated match to d1v8ga1 complexed with gol, na |
PDB Entry: 2elc (more details), 1.55 Å
SCOPe Domain Sequences for d2elcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2elcb1 a.46.2.1 (B:1-65) Anthranilate phosphoribosyltransferase (TrpD) {Thermus thermophilus [TaxId: 274]} mdavkkailgevleeeeayevmralmagevspvraagllvalslrgerpheiaamaramr eaarp
Timeline for d2elcb1: