Lineage for d2elba1 (2elb A:6-273)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015824Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2015825Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 2015826Family a.238.1.1: BAR domain [103658] (4 protein domains)
    sensor of membrane curvature
  6. 2015830Protein DCC-interacting protein 13-alpha, APPL1 [158643] (1 species)
  7. 2015831Species Human (Homo sapiens) [TaxId:9606] [158644] (1 PDB entry)
    Uniprot Q9UKG1 6-273
  8. 2015832Domain d2elba1: 2elb A:6-273 [146895]
    Other proteins in same PDB: d2elba2

Details for d2elba1

PDB Entry: 2elb (more details), 2.6 Å

PDB Description: Crystal Structure of the BAR-PH domain of human APPL1
PDB Compounds: (A:) Adapter protein containing PH domain, PTB domain and leucine zipper motif 1

SCOPe Domain Sequences for d2elba1:

Sequence, based on SEQRES records: (download)

>d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]}
klpieetledspqtrsllgvfeedataisnymnqlyqamhriydaqnelsaathltskll
keyekqrfplggddevmsstlqqfskvidelsschavlstqladammfpitqfkerdlke
iltlkevfqiasndhdaainrysrlskkrendkvkyevtedvytsrkkqhqtmmhyfcal
ntlqykkkiallepllgymqaqisffkmgsenlneqleeflanigtsvqnvrremdsdie
tmqqtiedlevasdplyvpdpdptdfpv

Sequence, based on observed residues (ATOM records): (download)

>d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]}
klpieetledspqtrsllgvfeedataisnymnqlyqamhriydaqnelsaathltskll
keyekqrfpevmsstlqqfskvidelsschavlstqladammfpitqfkerdlkeiltlk
evfqiasndhdaainrysrlskkvkyevtedvytsrkkqhqtmmhyfcalntlqykkkia
llepllgymqaqisffkmgsenlneqleeflanigtsvqnvrremdsdietmqqtiedle
vasdplyvpdpdptdfpv

SCOPe Domain Coordinates for d2elba1:

Click to download the PDB-style file with coordinates for d2elba1.
(The format of our PDB-style files is described here.)

Timeline for d2elba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2elba2