Lineage for d2el9c2 (2el9 C:3-325)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532556Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2532557Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2532558Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 protein domains)
  6. 2532629Protein Histidyl-tRNA synthetase (HisRS) [55688] (4 species)
  7. 2532630Species Escherichia coli [TaxId:562] [55689] (4 PDB entries)
  8. 2532637Domain d2el9c2: 2el9 C:3-325 [146892]
    Other proteins in same PDB: d2el9a1, d2el9b1, d2el9c1, d2el9d1
    automated match to d1kmma2
    protein/RNA complex; complexed with hss

Details for d2el9c2

PDB Entry: 2el9 (more details), 2.7 Å

PDB Description: Crystal structure of E.coli Histidyl-tRNA synthetase complexed with a histidyl-adenylate analogue
PDB Compounds: (C:) histidyl-tRNA synthetase

SCOPe Domain Sequences for d2el9c2:

Sequence, based on SEQRES records: (download)

>d2el9c2 d.104.1.1 (C:3-325) Histidyl-tRNA synthetase (HisRS) {Escherichia coli [TaxId: 562]}
kniqairgmndylpgetaiwqriegtlknvlgsygyseirlpiveqtplfkraigevtdv
vekemytfedrngdsltlrpegtagcvragiehgllynqeqrlwyigpmfrherpqkgry
rqfhqlgcevfglqgpdidaelimltarwwralgisehvtlelnsigslearanyrdalv
afleqhkekldedckrrmytnplrvldsknpevqallndapalgdyldeesrehfaglck
llesagiaytvnqrlvrgldyynrtvfewvtnslgsqgtvcaggrydglveqlggratpa
vgfamglerlvllvqavnpefka

Sequence, based on observed residues (ATOM records): (download)

>d2el9c2 d.104.1.1 (C:3-325) Histidyl-tRNA synthetase (HisRS) {Escherichia coli [TaxId: 562]}
kniqairgmndylpgetaiwqriegtlknvlgsygyseirlpiveqtplfkraigevtdv
vekemytfedrngdsltlrpegtagcvragiehgllynqeqrlwyigpmfrherpqkgry
rqfhqlgcevfglqgpdidaelimltarwwralgisehvtlelnsigslearanyrdagd
yldeesrehfaglckllesagiaytvnqrlvrgldyynrtvfewvtngtvcaggrydglv
eqlggratpavgfamglerlvllvqavnpefka

SCOPe Domain Coordinates for d2el9c2:

Click to download the PDB-style file with coordinates for d2el9c2.
(The format of our PDB-style files is described here.)

Timeline for d2el9c2: