SCOP 1.75: Domain d2el9c1: 2el9 C:326-424

Lineage for d2el9c1 (2el9 C:326-424)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)

6. Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species)

7. Species Escherichia coli [TaxId:562] [52957] (4 PDB entries)

8. Domain d2el9c1: 2el9 C:326-424 [146891]
   Other proteins in same PDB: d2el9a2, d2el9b2, d2el9c2, d2el9d2
   automatically matched to d1htta1
   complexed with hss

Details for d2el9c1

PDB Entry: 2el9, 2.7 Å

PDB Description: Crystal structure of E.coli Histidyl-tRNA synthetase complexed with a histidyl-adenylate analogue

PDB Compounds: (C:) histidyl-tRNA synthetase

SCOP Domain Sequences for d2el9c1:

Sequence; same for both SEQRES and ATOM records:

>d2el9c1 c.51.1.1 (C:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli [TaxId: 562]}
dpvvdiylvasgadtqsaamalaerlrdelpgvklmtnhgggnfkkqfaradkwgarvav
vlgesevangtavvkdlrsgeqtavaqdsvaahlrtllg

Timeline for d2el9c1:

• d2el9c1 is new in SCOP 1.75
  
• d2el9c1 appears in SCOPe 2.01
  
• d2el9c1 appears in the current release, SCOPe 2.08