Lineage for d2el9b1 (2el9 B:326-424)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489766Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2489767Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2489768Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 2489777Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species)
  7. 2489778Species Escherichia coli [TaxId:562] [52957] (4 PDB entries)
  8. 2489784Domain d2el9b1: 2el9 B:326-424 [146889]
    Other proteins in same PDB: d2el9a2, d2el9b2, d2el9c2, d2el9d2
    automated match to d1kmma1
    protein/RNA complex; complexed with hss

Details for d2el9b1

PDB Entry: 2el9 (more details), 2.7 Å

PDB Description: Crystal structure of E.coli Histidyl-tRNA synthetase complexed with a histidyl-adenylate analogue
PDB Compounds: (B:) histidyl-tRNA synthetase

SCOPe Domain Sequences for d2el9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2el9b1 c.51.1.1 (B:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli [TaxId: 562]}
dpvvdiylvasgadtqsaamalaerlrdelpgvklmtnhgggnfkkqfaradkwgarvav
vlgesevangtavvkdlrsgeqtavaqdsvaahlrtllg

SCOPe Domain Coordinates for d2el9b1:

Click to download the PDB-style file with coordinates for d2el9b1.
(The format of our PDB-style files is described here.)

Timeline for d2el9b1: