Lineage for d2el9a1 (2el9 A:326-424)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835189Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 835190Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families) (S)
  5. 835191Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 835200Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species)
  7. 835204Species Escherichia coli [TaxId:562] [52957] (4 PDB entries)
  8. 835209Domain d2el9a1: 2el9 A:326-424 [146887]
    Other proteins in same PDB: d2el9a2, d2el9b2, d2el9c2, d2el9d2
    automatically matched to d1htta1
    complexed with hss

Details for d2el9a1

PDB Entry: 2el9 (more details), 2.7 Å

PDB Description: Crystal structure of E.coli Histidyl-tRNA synthetase complexed with a histidyl-adenylate analogue
PDB Compounds: (A:) histidyl-tRNA synthetase

SCOP Domain Sequences for d2el9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2el9a1 c.51.1.1 (A:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli [TaxId: 562]}
dpvvdiylvasgadtqsaamalaerlrdelpgvklmtnhgggnfkkqfaradkwgarvav
vlgesevangtavvkdlrsgeqtavaqdsvaahlrtllg

SCOP Domain Coordinates for d2el9a1:

Click to download the PDB-style file with coordinates for d2el9a1.
(The format of our PDB-style files is described here.)

Timeline for d2el9a1: