Lineage for d2ekta_ (2ekt A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903195Protein Myoglobin [46469] (9 species)
  7. 903301Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (225 PDB entries)
    Uniprot P02185
  8. 903305Domain d2ekta_: 2ekt A: [146883]
    automated match to d104ma_
    complexed with 6he, so4

Details for d2ekta_

PDB Entry: 2ekt (more details), 1.1 Å

PDB Description: Crystal structure of myoglobin reconstituted with 6-methyl-6-depropionatehemin
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2ekta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ekta_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d2ekta_:

Click to download the PDB-style file with coordinates for d2ekta_.
(The format of our PDB-style files is described here.)

Timeline for d2ekta_: