SCOP 1.75: Domain d2ekta1: 2ekt A:1-153

Lineage for d2ekta1 (2ekt A:1-153)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (180 PDB entries)
   Uniprot P02185

8. Domain d2ekta1: 2ekt A:1-153 [146883]
   automatically matched to d1ufpa_
   complexed with 6he, so4

Details for d2ekta1

PDB Entry: 2ekt, 1.1 Å

PDB Description: Crystal structure of myoglobin reconstituted with 6-methyl-6-depropionatehemin

PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d2ekta1:

Sequence; same for both SEQRES and ATOM records:

>d2ekta1 a.1.1.2 (A:1-153) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d2ekta1:

• d2ekta1 is new in SCOP 1.75
  
• d2ekta1 is called d2ekta_ in SCOPe 2.01
  
• d2ekta1 appears in the current release, SCOPe 2.08, called d2ekta_