![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.4: Dihydroorotase [63917] (1 protein) |
![]() | Protein Dihydroorotase [63918] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [63919] (5 PDB entries) |
![]() | Domain d2eg8a1: 2eg8 A:4-346 [146830] automatically matched to d1xgea1 complexed with fot, zn |
PDB Entry: 2eg8 (more details), 2.2 Å
SCOP Domain Sequences for d2eg8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eg8a1 c.1.9.4 (A:4-346) Dihydroorotase {Escherichia coli [TaxId: 562]} sqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrqril davpaghdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvdaim pvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehittkda adyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvasgfn rvflgtdsapharhrkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngpqfy glpvndtfielvreeqqvaesialtddtlvpflagetvrwsvk
Timeline for d2eg8a1: