Lineage for d2eg8a_ (2eg8 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833666Family c.1.9.4: Dihydroorotase [63917] (2 proteins)
  6. 2833667Protein Dihydroorotase [63918] (1 species)
  7. 2833668Species Escherichia coli [TaxId:562] [63919] (14 PDB entries)
  8. 2833693Domain d2eg8a_: 2eg8 A: [146830]
    automated match to d1j79a_
    complexed with fot, zn

Details for d2eg8a_

PDB Entry: 2eg8 (more details), 2.2 Å

PDB Description: the crystal structure of e. coli dihydroorotase complexed with 5- fluoroorotic acid
PDB Compounds: (A:) dihydroorotase

SCOPe Domain Sequences for d2eg8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eg8a_ c.1.9.4 (A:) Dihydroorotase {Escherichia coli [TaxId: 562]}
sqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrqril
davpaghdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvdaim
pvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehittkda
adyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvasgfn
rvflgtdsapharhrkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngpqfy
glpvndtfielvreeqqvaesialtddtlvpflagetvrwsvk

SCOPe Domain Coordinates for d2eg8a_:

Click to download the PDB-style file with coordinates for d2eg8a_.
(The format of our PDB-style files is described here.)

Timeline for d2eg8a_: