Lineage for d2eg7a1 (2eg7 A:4-346)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 816850Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 816972Family c.1.9.4: Dihydroorotase [63917] (1 protein)
  6. 816973Protein Dihydroorotase [63918] (1 species)
  7. 816974Species Escherichia coli [TaxId:562] [63919] (5 PDB entries)
  8. 816981Domain d2eg7a1: 2eg7 A:4-346 [146828]
    automatically matched to d1xgea1
    complexed with otd, zn

Details for d2eg7a1

PDB Entry: 2eg7 (more details), 2 Å

PDB Description: the crystal structure of e. coli dihydroorotase complexed with hddp
PDB Compounds: (A:) dihydroorotase

SCOP Domain Sequences for d2eg7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eg7a1 c.1.9.4 (A:4-346) Dihydroorotase {Escherichia coli [TaxId: 562]}
sqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrqril
davpaghdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvdaim
pvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehittkda
adyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvasgfn
rvflgtdsapharhrkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngpqfy
glpvndtfielvreeqqvaesialtddtlvpflagetvrwsvk

SCOP Domain Coordinates for d2eg7a1:

Click to download the PDB-style file with coordinates for d2eg7a1.
(The format of our PDB-style files is described here.)

Timeline for d2eg7a1: