Lineage for d2eg6a_ (2eg6 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096081Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2096313Family c.1.9.4: Dihydroorotase [63917] (2 proteins)
  6. 2096314Protein Dihydroorotase [63918] (1 species)
  7. 2096315Species Escherichia coli [TaxId:562] [63919] (14 PDB entries)
  8. 2096318Domain d2eg6a_: 2eg6 A: [146826]
    automated match to d1j79a_
    complexed with zn

Details for d2eg6a_

PDB Entry: 2eg6 (more details), 1.7 Å

PDB Description: the crystal structure of the ligand-free dihydroorotase from e. coli
PDB Compounds: (A:) dihydroorotase

SCOPe Domain Sequences for d2eg6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eg6a_ c.1.9.4 (A:) Dihydroorotase {Escherichia coli [TaxId: 562]}
sqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrqril
davpaghdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvdaim
pvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehittkda
adyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvasgfn
rvflgtdsapharhrkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngpqfy
glpvndtfielvreeqqvaesialtddtlvpflagetvrwsvk

SCOPe Domain Coordinates for d2eg6a_:

Click to download the PDB-style file with coordinates for d2eg6a_.
(The format of our PDB-style files is described here.)

Timeline for d2eg6a_: