![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.4: Dihydroorotase [63917] (2 proteins) |
![]() | Protein Dihydroorotase [63918] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [63919] (14 PDB entries) |
![]() | Domain d2eg6a_: 2eg6 A: [146826] automated match to d1j79a_ complexed with zn |
PDB Entry: 2eg6 (more details), 1.7 Å
SCOPe Domain Sequences for d2eg6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eg6a_ c.1.9.4 (A:) Dihydroorotase {Escherichia coli [TaxId: 562]} sqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrqril davpaghdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvdaim pvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehittkda adyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvasgfn rvflgtdsapharhrkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngpqfy glpvndtfielvreeqqvaesialtddtlvpflagetvrwsvk
Timeline for d2eg6a_: