Lineage for d2efya_ (2efy A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907393Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2907681Protein automated matches [190054] (13 species)
    not a true protein
  7. 2907804Species Thermus thermophilus HB8 [TaxId:300852] [187272] (5 PDB entries)
  8. 2907810Domain d2efya_: 2efy A: [146824]
    automated match to d1ve1a1
    complexed with 4at, plp

Details for d2efya_

PDB Entry: 2efy (more details), 2.35 Å

PDB Description: Crystal Structure of T.th. HB8 O-acetylserine sulfhydrylase Complexed with 4-Acetylbutyric acid
PDB Compounds: (A:) O-acetylserine (Thiol)-lyase

SCOPe Domain Sequences for d2efya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2efya_ c.79.1.1 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrvegaigktpvvrlakvvepdmaevwvkleglnpggsikdrpawymikdaeergilrpg
sgqviveptsgntgiglamiaasrgyrliltmpaqmseerkrvlkafgaelvltdperrm
laareealrlkeelgafmpdqfknpanvrahyettgpelyealegridafvygsgtggti
tgvgrylkeriphvkviaveparsnvlsggkmgqhgfqgmgpgfipenldlslldgviqv
weedafplarrlareeglflgmssggivwaalqvarelgpgkrvacispdggwkylstpl
ya

SCOPe Domain Coordinates for d2efya_:

Click to download the PDB-style file with coordinates for d2efya_.
(The format of our PDB-style files is described here.)

Timeline for d2efya_: