SCOP 1.75: Domain d2efwf1: 2efw F:8-122

Lineage for d2efwf1 (2efw F:8-122)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein)

6. Protein Replication terminator protein (RTP) [46808] (1 species)
   contains long helix in the C-terminal extension; forms dimer similar to the LysR-like dimer

7. Species Bacillus subtilis [TaxId:1423] [46809] (6 PDB entries)

8. Domain d2efwf1: 2efw F:8-122 [146822]
   automatically matched to d1j0rb_
   mutant

Details for d2efwf1

PDB Entry: 2efw, 2.5 Å

PDB Description: crystal structure of the rtp:nrb complex from bacillus subtilis

PDB Compounds: (F:) Replication termination protein

SCOP Domain Sequences for d2efwf1:

Sequence; same for both SEQRES and ATOM records:

>d2efwf1 a.4.5.7 (F:8-122) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]}
stgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslhelldd
gilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsdnf

Timeline for d2efwf1:

• d2efwf1 is new in SCOP 1.75
  
• d2efwf1 is called d2efwf_ in SCOPe 2.01
  
• d2efwf1 appears in the current release, SCOPe 2.08, called d2efwf_