| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein) |
| Protein Replication terminator protein (RTP) [46808] (1 species) contains long helix in the C-terminal extension; forms dimer similar to the LysR-like dimer |
| Species Bacillus subtilis [TaxId:1423] [46809] (6 PDB entries) |
| Domain d2efwa_: 2efw A: [146820] automated match to d1bm9a_ protein/DNA complex |
PDB Entry: 2efw (more details), 2.5 Å
SCOPe Domain Sequences for d2efwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2efwa_ a.4.5.7 (A:) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]}
stgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslhelldd
gilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsdnf
Timeline for d2efwa_: