Lineage for d2efva1 (2efv A:6-87)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325749Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 2325750Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 2325953Family a.43.1.12: MJ0366-like [158488] (1 protein)
    PfamB PB022101; duplicated ribbon-helix-helix motif; forms trefoil knot; predicted DNA binding
    automatically mapped to Pfam PF10802
  6. 2325954Protein Uncharacterized protein MJ0366 [158489] (1 species)
  7. 2325955Species Methanococcus jannaschii [TaxId:2190] [158490] (1 PDB entry)
    Uniprot Q57812 6-87
  8. 2325956Domain d2efva1: 2efv A:6-87 [146819]
    complexed with po4

Details for d2efva1

PDB Entry: 2efv (more details), 1.9 Å

PDB Description: crystal structure of a hypothetical protein(mj0366) from methanocaldococcus jannaschii
PDB Compounds: (A:) Hypothetical protein MJ0366

SCOPe Domain Sequences for d2efva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2efva1 a.43.1.12 (A:6-87) Uncharacterized protein MJ0366 {Methanococcus jannaschii [TaxId: 2190]}
fmkekkratfylyknidgrklryllhklenvenvdidtlrraieaekkykrsitlteeee
viiqrlgksanlllncelvkld

SCOPe Domain Coordinates for d2efva1:

Click to download the PDB-style file with coordinates for d2efva1.
(The format of our PDB-style files is described here.)

Timeline for d2efva1: