SCOPe 2.05: Domain d2efva1: 2efv A:6-87

Lineage for d2efva1 (2efv A:6-87)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.12: MJ0366-like [158488] (1 protein)
   PfamB PB022101; duplicated ribbon-helix-helix motif; forms trefoil knot; predicted DNA binding
   automatically mapped to Pfam PF10802

6. Protein Uncharacterized protein MJ0366 [158489] (1 species)

7. Species Methanococcus jannaschii [TaxId:2190] [158490] (1 PDB entry)
   Uniprot Q57812 6-87

8. Domain d2efva1: 2efv A:6-87 [146819]
   complexed with po4

Details for d2efva1

PDB Entry: 2efv, 1.9 Å

PDB Description: crystal structure of a hypothetical protein(mj0366) from methanocaldococcus jannaschii

PDB Compounds: (A:) Hypothetical protein MJ0366

SCOPe Domain Sequences for d2efva1:

Sequence; same for both SEQRES and ATOM records:

>d2efva1 a.43.1.12 (A:6-87) Uncharacterized protein MJ0366 {Methanococcus jannaschii [TaxId: 2190]}
fmkekkratfylyknidgrklryllhklenvenvdidtlrraieaekkykrsitlteeee
viiqrlgksanlllncelvkld

Timeline for d2efva1:

• d2efva1 first appeared in SCOP 1.75
  
• d2efva1 appears in SCOPe 2.04
  
• d2efva1 appears in SCOPe 2.06
  
• d2efva1 appears in the current release, SCOPe 2.08