| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
| Family a.43.1.12: MJ0366-like [158488] (1 protein) PfamB PB022101; duplicated ribbon-helix-helix motif; forms trefoil knot; predicted DNA binding automatically mapped to Pfam PF10802 |
| Protein Uncharacterized protein MJ0366 [158489] (1 species) |
| Species Methanococcus jannaschii [TaxId:2190] [158490] (1 PDB entry) Uniprot Q57812 6-87 |
| Domain d2efva1: 2efv A:6-87 [146819] complexed with po4 |
PDB Entry: 2efv (more details), 1.9 Å
SCOPe Domain Sequences for d2efva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2efva1 a.43.1.12 (A:6-87) Uncharacterized protein MJ0366 {Methanococcus jannaschii [TaxId: 2190]}
fmkekkratfylyknidgrklryllhklenvenvdidtlrraieaekkykrsitlteeee
viiqrlgksanlllncelvkld
Timeline for d2efva1: