Lineage for d2efla1 (2efl A:1-288)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015824Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2015825Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 2015875Family a.238.1.4: FCH domain [158645] (2 protein domains)
    Pfam PF00611; Fes/CIP4 homology domain
  6. 2015879Protein Formin-binding protein 1, FNBP1 [158646] (1 species)
  7. 2015880Species Human (Homo sapiens) [TaxId:9606] [158647] (1 PDB entry)
    Uniprot Q96RU3 1-288
  8. 2015881Domain d2efla1: 2efl A:1-288 [146816]

Details for d2efla1

PDB Entry: 2efl (more details), 2.61 Å

PDB Description: Crystal structure of the EFC domain of formin-binding protein 17
PDB Compounds: (A:) Formin-binding protein 1

SCOPe Domain Sequences for d2efla1:

Sequence, based on SEQRES records: (download)

>d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]}
mswgtelwdqfdnlekhtqwgidilekyikfvkerteielsyakqlrnlskkyqpkknsk
eeeeykytsckafisnlnemndyagqhevisenmasqiivdlaryvqelkqerksnfhdg
rkaqqhietcwkqlesskrrferdckeadraqqyfekmdadinvtkadvekarqqaqirh
qmaedskadyssilqkfnheqheyyhthipnifqkiqemeerrivrmgesmktyaevdrq
vipiigkcldgivkaaesidqkndsqlvieayksgfeppgdiefedyt

Sequence, based on observed residues (ATOM records): (download)

>d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]}
mswgtelwdqfdnlekhtqwgidilekyikfvkerteielsyakqlrnlskkyqpkeyky
tsckafisnlnemndyagqhevisenmasqiivdlaryvqelkqerksnfhdgrkaqqhi
etcwkqlesskrrferdckeadraqqyfekmdadinvtkadvekarqqaqirhqmaedsk
adyssilqkfnheqheyyhthipnifqkiqemeerrivrmgesmktyaevdrqvipiigk
cldgivkaaesidqkndsqlvieayksgfeppgdiefedyt

SCOPe Domain Coordinates for d2efla1:

Click to download the PDB-style file with coordinates for d2efla1.
(The format of our PDB-style files is described here.)

Timeline for d2efla1: