Lineage for d2efka1 (2efk A:10-288)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015824Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2015825Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 2015875Family a.238.1.4: FCH domain [158645] (2 protein domains)
    Pfam PF00611; Fes/CIP4 homology domain
  6. 2015876Protein CDC42-interacting protein 4, CIP4 [158648] (1 species)
  7. 2015877Species Human (Homo sapiens) [TaxId:9606] [158649] (1 PDB entry)
    Uniprot Q15642 10-288
  8. 2015878Domain d2efka1: 2efk A:10-288 [146815]
    Other proteins in same PDB: d2efka2

Details for d2efka1

PDB Entry: 2efk (more details), 2.3 Å

PDB Description: Crystal structure of the EFC domain of Cdc42-interacting protein 4
PDB Compounds: (A:) Cdc42-interacting protein 4

SCOPe Domain Sequences for d2efka1:

Sequence, based on SEQRES records: (download)

>d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]}
qfevlerhtqwgldlldryvkfvkerteveqayakqlrslvkkylpkrpakddpeskfsq
qqsfvqilqevndfagqrelvaenlsvrvcleltkysqemkqerkmhfqegrraqqqlen
gfkqlenskrkferdcreaekaaqtaerldqdinatkadvekakqqahlrshmaeeskne
yaaqlqrfnrdqahfyfsqmpqifdklqdmderratrlgagygllseaelevvpiiakcl
egmkvaanavdpkndshvlielhksgfarpgdvefedfs

Sequence, based on observed residues (ATOM records): (download)

>d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]}
qfevlerhtqwgldlldryvkfvkerteveqayakqlrslvkkylpkeskfsqqqsfvqi
lqevndfagqrelvaenlsvrvcleltkysqemkqerkmhfqegrraqqqlengfkqlen
skrkferdcreaekaaqtaerldqdinatkadvekakqqahlrshmaeeskneyaaqlqr
fnrdqahfyfsqmpqifdklqdmderratrlgagygllseaelevvpiiakclegmkvaa
navdpkndshvlielhksgfarpgdvefedfs

SCOPe Domain Coordinates for d2efka1:

Click to download the PDB-style file with coordinates for d2efka1.
(The format of our PDB-style files is described here.)

Timeline for d2efka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2efka2