Lineage for d2efia1 (2efi A:13-95)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1311416Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 1311549Family b.34.13.3: Chromo barrel domain [117157] (4 proteins)
    typical SH3-like barrel fold; similar sequence motif to the canonical chromo domain
  6. 1311550Protein Mortality factor 4-like protein 1, MRG15 [141225] (1 species)
    MORF-related gene 15 isoform 1
  7. 1311551Species Human (Homo sapiens) [TaxId:9606] [141226] (2 PDB entries)
    Uniprot Q9UBU8 6-88
  8. 1311553Domain d2efia1: 2efi A:13-95 [146814]
    automatically matched to d2f5ka1

Details for d2efia1

PDB Entry: 2efi (more details)

PDB Description: solution structure of the chromo domain of mortality factor 4-like protein 1 from human
PDB Compounds: (A:) Mortality factor 4-like protein 1

SCOPe Domain Sequences for d2efia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2efia1 b.34.13.3 (A:13-95) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]}
dpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknwdewvpesrvlky
vdtnlqkqrelqkanqeqyaegk

SCOPe Domain Coordinates for d2efia1:

Click to download the PDB-style file with coordinates for d2efia1.
(The format of our PDB-style files is described here.)

Timeline for d2efia1: