SCOP 1.75: Domain d2efia1: 2efi A:13-95

Lineage for d2efia1 (2efi A:13-95)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (3 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.3: Chromo barrel domain [117157] (3 proteins)
   typical SH3-like barrel fold; similar sequence motif to the canonical chromo domain

6. Protein Mortality factor 4-like protein 1, MRG15 [141225] (1 species)
   MORF-related gene 15 isoform 1

7. Species Human (Homo sapiens) [TaxId:9606] [141226] (2 PDB entries)
   Uniprot Q9UBU8 6-88

8. Domain d2efia1: 2efi A:13-95 [146814]
   automatically matched to d2f5ka1

Details for d2efia1

PDB Entry: 2efi

PDB Description: solution structure of the chromo domain of mortality factor 4-like protein 1 from human

PDB Compounds: (A:) Mortality factor 4-like protein 1

SCOP Domain Sequences for d2efia1:

Sequence; same for both SEQRES and ATOM records:

>d2efia1 b.34.13.3 (A:13-95) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]}
dpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknwdewvpesrvlky
vdtnlqkqrelqkanqeqyaegk

Timeline for d2efia1:

• d2efia1 is new in SCOP 1.75
  
• d2efia1 appears in SCOPe 2.01
  
• d2efia1 appears in the current release, SCOPe 2.08, called d2efia2