SCOPe 2.08: Domain d2efia2: 2efi A:8-100

Lineage for d2efia2 (2efi A:8-100)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.3: Chromo barrel domain [117157] (4 proteins)
   typical SH3-like barrel fold; similar sequence motif to the canonical chromo domain

6. Protein automated matches [190429] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187320] (1 PDB entry)

8. Domain d2efia2: 2efi A:8-100 [146814]
   Other proteins in same PDB: d2efia3
   automated match to d2f5kb_

Details for d2efia2

PDB Entry: 2efi

PDB Description: solution structure of the chromo domain of mortality factor 4-like protein 1 from human

PDB Compounds: (A:) Mortality factor 4-like protein 1

SCOPe Domain Sequences for d2efia2:

Sequence; same for both SEQRES and ATOM records:

>d2efia2 b.34.13.3 (A:8-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mapkqdpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknwdewvpes
rvlkyvdtnlqkqrelqkanqeqyaegkmrgaa

Timeline for d2efia2:

• d2efia2 first appeared in SCOP 1.75, called d2efia1
  
• d2efia2 appears in SCOPe 2.07