![]() | Class j: Peptides [58231] (151 folds) |
![]() | Fold j.75: Isolated insulin B-chain [58773] (1 superfamily) |
![]() | Superfamily j.75.1: Isolated insulin B-chain [58774] (1 family) ![]() |
![]() | Family j.75.1.1: Isolated insulin B-chain [58775] (1 protein) |
![]() | Protein Isolated insulin B-chain [58776] (3 species) |
![]() | Species Synthetic construct [TaxId:32630] [161302] (2 PDB entries) |
![]() | Domain d2efab1: 2efa B:1-30 [146812] automatically matched to d1ho0a_ complexed with dod |
PDB Entry: 2efa (more details), 2.7 Å
SCOPe Domain Sequences for d2efab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2efab1 j.75.1.1 (B:1-30) Isolated insulin B-chain {Synthetic construct [TaxId: 32630]} fvnqhlcgshlvealylvcgergffytpka
Timeline for d2efab1: