Lineage for d2efab1 (2efa B:1-30)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3047022Fold j.75: Isolated insulin B-chain [58773] (1 superfamily)
  4. 3047023Superfamily j.75.1: Isolated insulin B-chain [58774] (1 family) (S)
  5. 3047024Family j.75.1.1: Isolated insulin B-chain [58775] (1 protein)
  6. 3047025Protein Isolated insulin B-chain [58776] (3 species)
  7. 3047080Species Synthetic construct [TaxId:32630] [161302] (2 PDB entries)
  8. 3047083Domain d2efab1: 2efa B:1-30 [146812]
    automatically matched to d1ho0a_
    complexed with dod

Details for d2efab1

PDB Entry: 2efa (more details), 2.7 Å

PDB Description: neutron crystal structure of cubic insulin at pd6.6
PDB Compounds: (B:) insulin

SCOPe Domain Sequences for d2efab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2efab1 j.75.1.1 (B:1-30) Isolated insulin B-chain {Synthetic construct [TaxId: 32630]}
fvnqhlcgshlvealylvcgergffytpka

SCOPe Domain Coordinates for d2efab1:

Click to download the PDB-style file with coordinates for d2efab1.
(The format of our PDB-style files is described here.)

Timeline for d2efab1: