Lineage for d2ef2a_ (2ef2 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1978082Protein Myoglobin [46469] (10 species)
  7. 1978220Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (266 PDB entries)
    Uniprot P02185
  8. 1978415Domain d2ef2a_: 2ef2 A: [146809]
    automated match to d1j3fa_
    complexed with po4, rhx

Details for d2ef2a_

PDB Entry: 2ef2 (more details), 1.8 Å

PDB Description: Crystal Structure of an Artificial Metalloprotein:Rh(Phebox-Ph)/apo-A71G Myoglobin
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2ef2a_:

Sequence, based on SEQRES records: (download)

>d2ef2a_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltglgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqg

Sequence, based on observed residues (ATOM records): (download)

>d2ef2a_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltglgailkkkghheaelkplaqshatkkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d2ef2a_:

Click to download the PDB-style file with coordinates for d2ef2a_.
(The format of our PDB-style files is described here.)

Timeline for d2ef2a_: