Lineage for d2ef1b_ (2ef1 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 983822Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 984019Family c.23.14.0: automated matches [191355] (1 protein)
    not a true family
  6. 984020Protein automated matches [190390] (2 species)
    not a true protein
  7. 984026Species Human (Homo sapiens) [TaxId:9606] [187252] (1 PDB entry)
  8. 984027Domain d2ef1b_: 2ef1 B: [146808]
    Other proteins in same PDB: d2ef1a1
    automated match to d1isfa_
    complexed with epe

Details for d2ef1b_

PDB Entry: 2ef1 (more details), 2.4 Å

PDB Description: Crystal structure of the extracellular domain of human CD38
PDB Compounds: (B:) ADP-ribosyl cyclase 1

SCOPe Domain Sequences for d2ef1b_:

Sequence, based on SEQRES records: (download)

>d2ef1b_ c.23.14.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcnitee
dyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefn
tskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmlngsrskifdknstfgs
vevhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkf
lqcvk

Sequence, based on observed residues (ATOM records): (download)

>d2ef1b_ c.23.14.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcnitee
dyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefn
tskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmlngsrskifdknstfgs
vevhnlqpekvqtleawvihrdlcqdptikelesiiskrniqfsckniyrpdkflqcvk

SCOPe Domain Coordinates for d2ef1b_:

Click to download the PDB-style file with coordinates for d2ef1b_.
(The format of our PDB-style files is described here.)

Timeline for d2ef1b_: