SCOPe 2.06: Domain d2ef1a1: 2ef1 A:45-291

Lineage for d2ef1a1 (2ef1 A:45-291)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families)
   there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members

5. Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
   contains extra N-terminal all-alpha subdomain
   automatically mapped to Pfam PF02267

6. Protein ADP ribosyl cyclase [56631] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159490] (42 PDB entries)
   Uniprot P28907 45-291

8. Domain d2ef1a1: 2ef1 A:45-291 [146807]
   Other proteins in same PDB: d2ef1b_
   complexed with epe

Details for d2ef1a1

PDB Entry: 2ef1, 2.4 Å

PDB Description: Crystal structure of the extracellular domain of human CD38

PDB Compounds: (A:) ADP-ribosyl cyclase 1

SCOPe Domain Sequences for d2ef1a1:

Sequence; same for both SEQRES and ATOM records:

>d2ef1a1 c.23.14.3 (A:45-291) ADP ribosyl cyclase {Human (Homo sapiens) [TaxId: 9606]}
rwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcnitee
dyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefn
tskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmlngsrskifdknstfgs
vevhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkf
lqcvknp

Timeline for d2ef1a1:

• d2ef1a1 first appeared in SCOP 1.75
  
• d2ef1a1 appears in SCOPe 2.05
  
• d2ef1a1 appears in SCOPe 2.07
  
• d2ef1a1 appears in the current release, SCOPe 2.08