Lineage for d2ee8a_ (2ee8 A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1704720Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 1704721Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 1704722Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 1704945Protein automated matches [192458] (2 species)
    not a true protein
  7. 1705039Species Mouse (Mus musculus) [TaxId:10090] [161315] (1 PDB entry)
  8. 1705040Domain d2ee8a_: 2ee8 A: [146806]
    automated match to d2ee8a1
    complexed with zn

Details for d2ee8a_

PDB Entry: 2ee8 (more details)

PDB Description: solution structure of three zf-c2h2 domains from mouse protein odd- skipped-related 2 splicing isoform 2
PDB Compounds: (A:) Protein odd-skipped-related 2

SCOPe Domain Sequences for d2ee8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ee8a_ g.37.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gssgssggrlpsktkkefickfcgrhftksynlliherthtderpytcdichkafrrqdh
lrdhryihskekpfkcqecgkgfcqsrtlavhktlhmqtssptaas

SCOPe Domain Coordinates for d2ee8a_:

Click to download the PDB-style file with coordinates for d2ee8a_.
(The format of our PDB-style files is described here.)

Timeline for d2ee8a_: