Lineage for d2ee8a1 (2ee8 A:15-96)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462985Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 1462986Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 1462987Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 1463213Protein automated matches [192458] (2 species)
    not a true protein
  7. 1463307Species Mouse (Mus musculus) [TaxId:10090] [161315] (1 PDB entry)
  8. 1463308Domain d2ee8a1: 2ee8 A:15-96 [146806]
    automatically matched to d1meyf_
    complexed with zn

Details for d2ee8a1

PDB Entry: 2ee8 (more details)

PDB Description: Solution structure of three zf-C2H2 domains from mouse protein odd-skipped-related 2 splicing isoform 2
PDB Compounds: (A:) Protein odd-skipped-related 2

SCOPe Domain Sequences for d2ee8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ee8a1 g.37.1.1 (A:15-96) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kkefickfcgrhftksynlliherthtderpytcdichkafrrqdhlrdhryihskekpf
kcqecgkgfcqsrtlavhktlh

SCOPe Domain Coordinates for d2ee8a1:

Click to download the PDB-style file with coordinates for d2ee8a1.
(The format of our PDB-style files is described here.)

Timeline for d2ee8a1: