Lineage for d2ee8a1 (2ee8 A:15-96)

  1. Root: SCOP 1.75
  2. 900990Class k: Designed proteins [58788] (44 folds)
  3. 901215Fold k.12: Zinc finger design [58856] (1 superfamily)
  4. 901216Superfamily k.12.1: Zinc finger design [58857] (1 family) (S)
  5. 901217Family k.12.1.1: Zinc finger design [58858] (7 proteins)
  6. 901222Protein Designed zinc finger protein [58859] (3 species)
  7. 901311Species Mus musculus [TaxId:10090] [161315] (1 PDB entry)
  8. 901312Domain d2ee8a1: 2ee8 A:15-96 [146806]
    automatically matched to d1meyf_

Details for d2ee8a1

PDB Entry: 2ee8 (more details)

PDB Description: solution structure of three zf-c2h2 domains from mouse protein odd- skipped-related 2 splicing isoform 2
PDB Compounds: (A:) Protein odd-skipped-related 2

SCOP Domain Sequences for d2ee8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ee8a1 k.12.1.1 (A:15-96) Designed zinc finger protein {Mus musculus [TaxId: 10090]}
kkefickfcgrhftksynlliherthtderpytcdichkafrrqdhlrdhryihskekpf
kcqecgkgfcqsrtlavhktlh

SCOP Domain Coordinates for d2ee8a1:

Click to download the PDB-style file with coordinates for d2ee8a1.
(The format of our PDB-style files is described here.)

Timeline for d2ee8a1: