SCOPe 2.08: Domain d2ee8a2: 2ee8 A:8-100

Lineage for d2ee8a2 (2ee8 A:8-100)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families)

5. Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)

6. Protein automated matches [192458] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [161315] (1 PDB entry)

8. Domain d2ee8a2: 2ee8 A:8-100 [146806]
   Other proteins in same PDB: d2ee8a3, d2ee8a4
   automated match to d2ee8a1
   complexed with zn
   multiple common domains: applies to families that are inconsistently divided into domains

Details for d2ee8a2

PDB Entry: 2ee8

PDB Description: solution structure of three zf-c2h2 domains from mouse protein odd- skipped-related 2 splicing isoform 2

PDB Compounds: (A:) Protein odd-skipped-related 2

SCOPe Domain Sequences for d2ee8a2:

Sequence; same for both SEQRES and ATOM records:

>d2ee8a2 g.37.1.1 (A:8-100) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
grlpsktkkefickfcgrhftksynlliherthtderpytcdichkafrrqdhlrdhryi
hskekpfkcqecgkgfcqsrtlavhktlhmqts

Timeline for d2ee8a2:

• d2ee8a2 first appeared in SCOP 1.75, called d2ee8a1
  
• d2ee8a2 appears in SCOPe 2.07