![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
![]() | Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) ![]() |
![]() | Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins) |
![]() | Protein automated matches [192458] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [161315] (1 PDB entry) |
![]() | Domain d2ee8a2: 2ee8 A:8-100 [146806] Other proteins in same PDB: d2ee8a3, d2ee8a4 automated match to d2ee8a1 complexed with zn multiple common domains: applies to families that are inconsistently divided into domains |
PDB Entry: 2ee8 (more details)
SCOPe Domain Sequences for d2ee8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ee8a2 g.37.1.1 (A:8-100) automated matches {Mouse (Mus musculus) [TaxId: 10090]} grlpsktkkefickfcgrhftksynlliherthtderpytcdichkafrrqdhlrdhryi hskekpfkcqecgkgfcqsrtlavhktlhmqts
Timeline for d2ee8a2: