Lineage for d2edma1 (2edm A:41-201)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2434317Fold b.170: WSSV envelope protein-like [158973] (1 superfamily)
    beta-sandwich; 9 strands in 2 sheets; greek-key
  4. 2434318Superfamily b.170.1: WSSV envelope protein-like [158974] (1 family) (S)
    automatically mapped to Pfam PF12175
  5. 2434319Family b.170.1.1: WSSV envelope protein-like [158975] (2 proteins)
  6. 2434320Protein Envelope protein VP26 [158978] (1 species)
  7. 2434321Species White spot syndrome virus, WSSV [TaxId:92652] [158979] (1 PDB entry)
    Uniprot Q9ICG6 41-201
  8. 2434322Domain d2edma1: 2edm A:41-201 [146804]

Details for d2edma1

PDB Entry: 2edm (more details), 2.2 Å

PDB Description: Crystal Structure of Envelope Protein VP26 from White Spot Syndrome Virus (WSSV)
PDB Compounds: (A:) 22kDa structural protein VP22

SCOPe Domain Sequences for d2edma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2edma1 b.170.1.1 (A:41-201) Envelope protein VP26 {White spot syndrome virus, WSSV [TaxId: 92652]}
svvanydqmmrvpiqrrakvmsirgersyntplgkvamknglsdkdmkdvsadlvistvt
aprtdpagtgaensnmtlkilnntgvdllinditvrptviagnikgntmsntyfsskdik
sssskitlidvcskfedgaafeatmnigftsknvidikdei

SCOPe Domain Coordinates for d2edma1:

Click to download the PDB-style file with coordinates for d2edma1.
(The format of our PDB-style files is described here.)

Timeline for d2edma1: