Class b: All beta proteins [48724] (178 folds) |
Fold b.170: WSSV envelope protein-like [158973] (1 superfamily) beta-sandwich; 9 strands in 2 sheets; greek-key |
Superfamily b.170.1: WSSV envelope protein-like [158974] (1 family) automatically mapped to Pfam PF12175 |
Family b.170.1.1: WSSV envelope protein-like [158975] (2 proteins) |
Protein Envelope protein VP26 [158978] (1 species) |
Species White spot syndrome virus, WSSV [TaxId:92652] [158979] (1 PDB entry) Uniprot Q9ICG6 41-201 |
Domain d2edma1: 2edm A:41-201 [146804] |
PDB Entry: 2edm (more details), 2.2 Å
SCOPe Domain Sequences for d2edma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2edma1 b.170.1.1 (A:41-201) Envelope protein VP26 {White spot syndrome virus, WSSV [TaxId: 92652]} svvanydqmmrvpiqrrakvmsirgersyntplgkvamknglsdkdmkdvsadlvistvt aprtdpagtgaensnmtlkilnntgvdllinditvrptviagnikgntmsntyfsskdik sssskitlidvcskfedgaafeatmnigftsknvidikdei
Timeline for d2edma1: