Lineage for d2ed6l1 (2ed6 L:32-201)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 814081Fold b.170: WSSV envelope protein-like [158973] (1 superfamily)
    beta-sandwich; 9 strands in 2 sheets; greek-key
  4. 814082Superfamily b.170.1: WSSV envelope protein-like [158974] (1 family) (S)
  5. 814083Family b.170.1.1: WSSV envelope protein-like [158975] (2 proteins)
  6. 814087Protein Envelope protein VP28 [158976] (1 species)
  7. 814088Species White spot syndrome virus, WSSV [TaxId:92652] [158977] (1 PDB entry)
    Uniprot Q9ICB7 32-201
  8. 814100Domain d2ed6l1: 2ed6 L:32-201 [146803]
    automatically matched to 2ED6 A:32-201

Details for d2ed6l1

PDB Entry: 2ed6 (more details), 2 Å

PDB Description: Crystal Structure of Envelope Protein VP28 from White Spot Syndrome Virus (WSSV)
PDB Compounds: (L:) 25kDa structural protein VP25

SCOP Domain Sequences for d2ed6l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ed6l1 b.170.1.1 (L:32-201) Envelope protein VP28 {White spot syndrome virus, WSSV [TaxId: 92652]}
tvtktiethtdnietnmdenlripvtaevgsgyfkmtdvsfdsdtlgkikirngksdaqm
keedadlvitpvegralevtvgqnltfegtfkvwnntsrkinitgmqmvpkinpskafvg
ssntssftpvsidedevgtfvcgttfgapiaataggnlfdmyvhvtysgt

SCOP Domain Coordinates for d2ed6l1:

Click to download the PDB-style file with coordinates for d2ed6l1.
(The format of our PDB-style files is described here.)

Timeline for d2ed6l1: