Lineage for d2ed6c_ (2ed6 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825577Fold b.170: WSSV envelope protein-like [158973] (1 superfamily)
    beta-sandwich; 9 strands in 2 sheets; greek-key
  4. 2825578Superfamily b.170.1: WSSV envelope protein-like [158974] (1 family) (S)
    automatically mapped to Pfam PF12175
  5. 2825579Family b.170.1.1: WSSV envelope protein-like [158975] (2 proteins)
  6. 2825583Protein Envelope protein VP28 [158976] (1 species)
  7. 2825584Species White spot syndrome virus, WSSV [TaxId:92652] [158977] (1 PDB entry)
    Uniprot Q9ICB7 32-201
  8. 2825587Domain d2ed6c_: 2ed6 C: [146794]
    automated match to d2ed6a1

Details for d2ed6c_

PDB Entry: 2ed6 (more details), 2 Å

PDB Description: Crystal Structure of Envelope Protein VP28 from White Spot Syndrome Virus (WSSV)
PDB Compounds: (C:) 25kDa structural protein VP25

SCOPe Domain Sequences for d2ed6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ed6c_ b.170.1.1 (C:) Envelope protein VP28 {White spot syndrome virus, WSSV [TaxId: 92652]}
tvtktiethtdnietnmdenlripvtaevgsgyfkmtdvsfdsdtlgkikirngksdaqm
keedadlvitpvegralevtvgqnltfegtfkvwnntsrkinitgmqmvpkinpskafvg
ssntssftpvsidedevgtfvcgttfgapiaataggnlfdmyvhvtysgt

SCOPe Domain Coordinates for d2ed6c_:

Click to download the PDB-style file with coordinates for d2ed6c_.
(The format of our PDB-style files is described here.)

Timeline for d2ed6c_: