![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.170: WSSV envelope protein-like [158973] (1 superfamily) beta-sandwich; 9 strands in 2 sheets; greek-key |
![]() | Superfamily b.170.1: WSSV envelope protein-like [158974] (1 family) ![]() automatically mapped to Pfam PF12175 |
![]() | Family b.170.1.1: WSSV envelope protein-like [158975] (2 proteins) |
![]() | Protein Envelope protein VP28 [158976] (1 species) |
![]() | Species White spot syndrome virus, WSSV [TaxId:92652] [158977] (1 PDB entry) Uniprot Q9ICB7 32-201 |
![]() | Domain d2ed6c_: 2ed6 C: [146794] automated match to d2ed6a1 |
PDB Entry: 2ed6 (more details), 2 Å
SCOPe Domain Sequences for d2ed6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ed6c_ b.170.1.1 (C:) Envelope protein VP28 {White spot syndrome virus, WSSV [TaxId: 92652]} tvtktiethtdnietnmdenlripvtaevgsgyfkmtdvsfdsdtlgkikirngksdaqm keedadlvitpvegralevtvgqnltfegtfkvwnntsrkinitgmqmvpkinpskafvg ssntssftpvsidedevgtfvcgttfgapiaataggnlfdmyvhvtysgt
Timeline for d2ed6c_: