SCOP 1.75: Domain d2ecoa1: 2eco A:1-302

Lineage for d2ecoa1 (2eco A:1-302)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)

6. Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)

7. Species Thermus thermophilus [TaxId:274] [142743] (4 PDB entries)
   Uniprot Q5SLE6 1-302

8. Domain d2ecoa1: 2eco A:1-302 [146790]
   automatically matched to d1ve1a1
   complexed with 4mv, plp

Details for d2ecoa1

PDB Entry: 2eco, 1.9 Å

PDB Description: Crystal Structure of T.th. HB8 O-acetylserine sulfhydrylase Complexed with 4-methylvalerate

PDB Compounds: (A:) O-acetylserine (Thiol)-lyase

SCOP Domain Sequences for d2ecoa1:

Sequence; same for both SEQRES and ATOM records:

>d2ecoa1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]}
mrvegaigktpvvrlakvvepdmaevwvkleglnpggsikdrpawymikdaeergilrpg
sgqviveptsgntgiglamiaasrgyrliltmpaqmseerkrvlkafgaelvltdperrm
laareealrlkeelgafmpdqfknpanvrahyettgpelyealegridafvygsgtggti
tgvgrylkeriphvkviaveparsnvlsggkmgqhgfqgmgpgfipenldlslldgviqv
weedafplarrlareeglflgmssggivwaalqvarelgpgkrvacispdggwkylstpl
ya

Timeline for d2ecoa1:

• d2ecoa1 is new in SCOP 1.75
  
• d2ecoa1 is called d2ecoa_ in SCOPe 2.01
  
• d2ecoa1 appears in the current release, SCOPe 2.08, called d2ecoa_